PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 291aa    MW: 32747 Da    PI: 9.2168
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028638genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-174691147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G  +W++Ia+++  gR++k+c++rw++ 
      Lus10028638 46 RGHWRPAEDEKLRQLVEKYGAQNWNSIAEKLH-GRSGKSCRLRWFNQ 91
                     899*****************************.***********996 PP

2Myb_DNA-binding54.82.2e-1798141146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W+ I+r ++ gRt++ +k++w+ 
      Lus10028638  98 RRPFTKEEEERLLVAHRIHGNK-WAFISRLFP-GRTDNAVKNHWHV 141
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5734192IPR017930Myb domain
SuperFamilySSF466897.11E-3044139IPR009057Homeodomain-like
SMARTSM007172.0E-144594IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-274799IPR009057Homeodomain-like
PfamPF139217.0E-1849109No hitNo description
CDDcd001673.72E-134990No hitNo description
PROSITE profilePS5129425.96493147IPR017930Myb domain
SMARTSM007171.2E-1497145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-20100146IPR009057Homeodomain-like
CDDcd001679.59E-11100140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGDQSGVCDH EAGKGGGGGV TKYNSCNSSS SSSTYNNNNS SSSCPRGHWR PAEDEKLRQL  60
VEKYGAQNWN SIAEKLHGRS GKSCRLRWFN QLDPRINRRP FTKEEEERLL VAHRIHGNKW  120
AFISRLFPGR TDNAVKNHWH VIMARKQREH SKLSDNKFVS SSRFCPTSKT NTTTSSPQSY  180
FKEAINGNYH SQYIYNKSGC GPCIDHTGRG SNLWNWVGCR VIVPSRFGYG SKVGDHGNHD  240
YNDAIKGHNH DIVKNQRVED HNEEEEDERR RSESVAPSFI DFLGVGVSSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30461467107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8307807e-53EU830780.1 Linum usitatissimum clone LU0030G02 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-62myb domain protein 52